Transcription factor AP-1

V-jun avian sarcoma virus 17 oncogene homolog lclBSEQ0016292Transcription factor AP-1 MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA LSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETP PLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF transcription regulatory region DNA binding RNA polymerase II transcription factor activity, sequence-specific DNA binding RNA polymerase II core promoter proximal region sequence-specific DNA binding transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding transcription factor activity,

Transcription factor HIF1A downstream targets associated pathways polymorphic hypoxia response element (HRE) sites and initiative for standardization

Where do you prefer to publish?Tell us in our 10 minute survey.Charitable donation for first 1000 responses. November 2016,Volume 37,Issue 11,pp 1485114861Cite as Transcription factor HIF1A: downstream targets, associated pathways, polymorphic hypoxia response element (HRE) sites, and initiative for standardization of reporting in scientific literature Hypoxia-inducible factor-1 (HIF-1) has crucial role in adapting cells to hypoxia

AthaMap-assisted transcription factor target gene identification in Arabidopsis thaliana Database

Lorenz Blow, Yuri Brill and Reinhard Hehl Available inOxford Journals» full text: open access Show all results sharing these subjects: The AthaMap database generates a map of potential transcription factor binding sites (TFBS) and small RNA target sites in theArabidopsis thalianagenome. The database contains sites for 115 different transcription factors (TFs). TFBS were identified with

rSNP_Guide a database system for analysis of transcription factor binding to target sequences application to SNPs and site-directed mutations

Atlas of Genetics and Cytogenetics in Oncology and Haematology, updatedAtlas of Genetics and Cytogenetics in Oncology and Haematology, updated ALFRED: an allele frequency database for diverse populations and DNA …ALFRED: an allele frequency database for diverse populations and DNA polymorphismsan update STRBase: a short tandem repeat DNA database for the human identity testing …STRBase: a

Transcription factor regulation can be accurately predicted from the presence of target gene

Deciphering transcription factor networks from microarray data remains difficult. This study presents a simple method to infer the regulation of transcription factors from microarray data based on well-characterized target genes. We generated a catalog containing transcription factors associated with 2720 target genes and 6401 experimentally validated regulations. When it was available, a distinction between transcriptional

Identification of direct regulatory targets of the transcription factor Sox10 based on function and conservation

Where do you prefer to publish? Tell us in our10 minute survey. Charitable donation for first 1000 responses! © Lee et al; licensee BioMed Central Ltd. 2008 Sox10, a member of the Sry-related HMG-Box gene family, is a critical transcription factor for several important cell lineages, most notably the neural crest stem cells and the